SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019994 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019994
Domain Number 1 Region: 258-396
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.72e-26
Family UBX domain 0.0089
Further Details:      
 
Domain Number 2 Region: 3-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000521
Family Thioltransferase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019994   Gene: ENSGALG00000012259   Transcript: ENSGALT00000020021
Sequence length 511
Comment pep:known_by_projection chromosome:Galgal4:7:30134926:30148126:1 gene:ENSGALG00000012259 transcript:ENSGALT00000020021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWFGGSIPAAIAAAKQQSSVFVVFVSGEDEQSTEMAARWEDAQVTEAASDGFVAIKIDT
KSEACLQFSQIYPVVCVPSSFFIGDNGIPLEVIAGSVSVEELVTRIHKVKQMHAEKGRPL
ENPCQSSAPCPSSPSHGAPENVQSTAEDPRGSPESVMSEPRPSDALADGANSGQASQEAT
QSSDEQVSNAQPANDLALKVERITKKLEERREEKRKEEEQKEIKKEIERRKTGKEMLEYK
RRQEEELTKRMLEERNREKAEEKAARERIRQQIALDRAERAARFAKSKEEAEAAKAAALQ
AKQAEIEARKEASQKERSAIARIQFRLPDGSSFTNQFPSEARLEEARQFAAQTVGNAYGN
FSLATMFPRREFTKEDYGKKLLELELAPSASVVLLPAGRPATSVVQASGGDLWKFLGTIL
YPLLAVWRFISNFLFTSPPPSESTVRTVHQQDHSNPSNSNNVEQSRQTVRKRVTEKRGED
FKKEGKIYRLRTQDDGEDENNTWNGNSTQQM
Download sequence
Identical sequences E1C2Q4
XP_422138.1.86415 ENSGALP00000019994 9031.ENSGALP00000019994 ENSGALP00000019994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]