SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024227 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024227
Domain Number 1 Region: 433-640
Classification Level Classification E-value
Superfamily PUA domain-like 7.21e-76
Family SRA domain-like 0.0000000131
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.14e-17
Family Ubiquitin-related 0.0000695
Further Details:      
 
Domain Number 3 Region: 735-802
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000194
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 328-397
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000532
Family PHD domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024227   Gene: ENSGALG00000015052   Transcript: ENSGALT00000024273
Sequence length 815
Comment pep:known_by_projection chromosome:Galgal4:Z:27804665:27885579:1 gene:ENSGALG00000015052 transcript:ENSGALT00000024273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIQVRTIDGTETQTIDDLSRLTKIECLREKIQETFRVSPDRQRLFYRGKQLEDGHTLFD
YNVGLNDIVQLLIRSESEAPASASMTDQDGEVNPCAISNCKNKVKKTSSGSPSQPSTSSR
SFLIDPGIGLYKINELVDARDVSIGAWFEAHIENVTRATKGHKNGKAQGKSSNTYKRTNG
SLNQDHSRENANNLDSTPSTSYSDCMDTEEVIYHIKYDEYPESGIVEMDINNLRPRARTI
LKWSELKVGDVVMVNYNVETPEERGFWFDAEITSLREISRTNKEVHAKILLGGPEDTIND
CKILFIEEMYKIEKPGAYPLTFGDGDFKRKSGPECKHCRADPDKECRFCSCYLCGGKQDA
HMQLLCDECNMAYHIYCLNPPLSKIPEDEDWYCPSCKNDSNEVVKAGEKLKQSKKKAKMP
SASTESQRDWGKGMACVGRTKECTIVPSNHYGPIPGVPVGTTWKFRVQVSEAGVHRPHVG
GIHGRSNDGAYSLVLAGGFEDEVDRGDEFTYTGSGGRDLSGNKRIGEHSFDQTLTHMNRA
LALNCDAPLDDKNGAESKNWRAGKPVRVVRSSKGRRISKYAPEEGNRYDGIYKVVKYWPE
IGKCGFLVWRYLLRRDDVEPAPWTSEGMERTKKLGLSVQYPEGYLEAMASKEKKDKVKKQ
TVKQEPTSQSNGNQKRTIDDGIEEPTNTPKAMRMGDGGKGEAFQLTQEQQWLIREDCMNQ
KLWDEVLASLKEGPNFLKKLEQSFMCVCCQELVYQPVTTECLHNVCKSCLQRSFRAEVFT
CPACRYDLGKSYTMVPNKILQTLLDQFFPGYSKGR
Download sequence
Identical sequences F1NS44
XP_003643050.1.86415 ENSGALP00000024227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]