SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000032611 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000032611
Domain Number 1 Region: 625-1048
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.32e-118
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000116
Further Details:      
 
Domain Number 2 Region: 24-290
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-77
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000904
Further Details:      
 
Domain Number 3 Region: 291-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.09e-75
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000637
Further Details:      
 
Domain Number 4 Region: 1439-1607
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.12e-53
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000032611   Gene: ENSGALG00000008900   Transcript: ENSGALT00000033251
Sequence length 1912
Comment pep:known chromosome:Galgal4:8:17537065:17580564:1 gene:ENSGALG00000008900 transcript:ENSGALT00000033251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLISALVLTLVGSQHLNYQPDFGENKVYTYNYESILFSGIPEKGLARTGIRIRSEVEI
SGIGPKLCLIRIHSIEAAEYNGIWPTSSFSRSLKLTQALTGQLSIPIKFEYSNGHVGNLM
APDSVSDDGLNIYRGILNILELSLKKMQHSYSIQEAGIGGICNTTYAIQENKKANLVDVT
KSKDLNSCEEKVQVVTGSAYTQPCQTCQQRNKNSRATATYNYKIKYTHNEAVITQAEVEE
VHQFTPFHEITGGNAIVEARQKLALIEVQKQVAEVPPKEFQKRGSLQYQFGSELLQLPVH
LFKIKDVERQIEERLQDLVETTYEQLPSDAPAKALKLMHLLRAANEENYESVWKQFSSRP
AYRRYLLDLLPAAASHRSLRFLRHKMERQELTNWEIAQTVLVALHSSSPTQEVMEEATLI
VKKHCPRSSSVLRKVCLLSYASLCHKRCSSPYSCSECLQVFHVFAGEALGKSNIEEVLLA
LKALGNVGHPASIKHIKKFLPGYAAGASELPLKVHETAVMALKSIGMRDPKMVQAITLEI
FLNHKIHPRIRMLAAVVLLETKPGLPILMILVDAVLKEPSMQVASFIYSHLRALGRSTAP
DLQMMASACRMAVRALSPKFDRSGYQFSKVFRFSMFKEFLMSGLAAKYFVLNNAGSLIPT
MAVSQLRTHFLGRVADPIEVGIAAEGLQEMFVRGYSPDKDWETNYDFREILKKLSDWKAL
PRDKPFASGYLKMFGQELLFGRLDKDTLQNVLQVWYGPDEKIPSIRRLISSLQTGIGRQW
TKALLLSEIRCIVPTCVGFPMETSFYYSSVTKVAGNVQAQITPSPRSDFRLTELLNSNVR
LRSKMSLSMAKHMTFVIGINTNMIQAGLEAHTKVNAHVPVNVVATIQMKEKSIKAEIPPC
KEETNLIIVSSKTFAVTRNIEDLAASKMTPVLLPEAVPDIMKMSFDSNSASGETDNIRDR
QSVEDVSSGNSFSFGHPSSGKEPFIQSMCSNASTFGVQVCIEKKSVHAAFIRNVPLYNAI
GEHALRMSFKPVYSDVPIEKIQVTIQAGDQAPTKMVRLVTFEDPERQESSRKEVMKRVKK
ILDDTDNQATRNSRSSSSSASSISESSESTTSTPSSSDSDNRASQGDPQINLKSRQSKAN
EKKFYPFGDSSSSGSSSSSSSSSSSSSDSSSSSRSSSSSDSSSSSSSSSSSSSSKSKSSS
RSSKSNRSSSSSNSKDSSSSSSKSNSKGSSSSSSKASGTRQKAKKQSKTTSFPHASAAEG
ERSVHEQKQETQSSSSSSSRASSNSRSTSSSTSSSSESSGVSHRQWKQDREAETKRVKSQ
FNSHSSYDIPNEWETYLPKVYRLRFRSAHTHWHSGHRTSSSSSSSSSESGSSHSNSSSSD
SSSRRSHMSDSSSSSSSHRHGEKAAHSSRRSPTSRAASAHHRPGSSLTRERNFLGDVIPP
GITIVAQAVRSDNRNQGYQATAYVRSDAAKVDVQLVVVQLAETNWKACADAVILPLKAQA
RMRWGKECRDYRIAAWATTGQMARKLAVQLKVQWGIIPSWIKKTSTALMRYVPGVALVLG
FSEAHQRNPSRELIVRAVATSPRSIDTVIKVPGVTLYYQGLRVPFTLPLGPSSSSYETRD
ITAWNFLPEIASQIAQEDQSTCEVSKGDFKTFDRMSFTCSFNKSCNVVVAQDCTEHPKFI
ITTRKVDHQSLSREVHINTSSANITICPAADSSLLVTCNKESVLSDSGVSEYEKDNIKIY
KNGKTVIVEAPIHGLKNVNFDGEILKVTVASWMRGKTCGVCGNNDREKHNELLMPNHKLA
HSCSAFVHSWVLLEETCSGGCKLQRSYVKLNRNPTIDGEESTCYSVDPVLKCMKDCTPIE
KTSVKVGFHCFPKATAVSLLEWQRSSDKKSASEDVVESVDADIDCTCTGDCS
Download sequence
Identical sequences ENSGALP00000032611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]