SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000039237 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000039237
Domain Number 1 Region: 360-526,828-1046,1092-1129
Classification Level Classification E-value
Superfamily Ras GEF 3.27e-109
Family Ras GEF 0.00012
Further Details:      
 
Domain Number 2 Region: 507-596
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-19
Family PDZ domain 0.008
Further Details:      
 
Domain Number 3 Region: 238-362
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-17
Family cAMP-binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 2-95
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000144
Family cAMP-binding domain 0.0056
Further Details:      
 
Domain Number 5 Region: 738-817
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000005
Family Ras-binding domain, RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000039237   Gene: ENSGALG00000006569   Transcript: ENSGALT00000040030
Sequence length 1627
Comment pep:known chromosome:Galgal4:13:15796907:15904202:-1 gene:ENSGALG00000006569 transcript:ENSGALT00000040030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLNTIYSFLHGLDILSHFREHQLRIMSSSARYERYKGNQVLFCSETIARCWYILLSGSV
LMKDSMFLPPCSFGKQSGGKRGCECIILEPSEMIVVENSKDNEESILQREVPLRQSRRRF
RKINQRGERQTITDNVDASSYLSLPADLTKMHLTDNPHPQVTHVPSSQSGCSIASDSGSS
SLSDIYQATESEMGDVDLTGLPEAPVDSEDEEEEEDEDIDRTSDPLLGRDVVRECLEKEP
ADKTDDDIEQLLEFMHQLPAFANMTMSVRRELCSVMIFEVVEQAGAIILEDGQELDSWYV
ILNGTVEISYPDGKSESLCMGNSFGITPSLDKQYMNGVVRTKVDDCQFVCIAQQDYWRIL
NHVEKNTHKVEEEGEIVMVKEHRELDRSGTRKGHIVIKATPERLIMHLIEEHSIVDPTYI
EDFLLTYRTFLTSPLEVGNKLLEWFTVDSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLE
EFEKNLENTKMKGHLRLLNIACAAKAKWRQITLQKPSRDSPLFFSLLGGSDKGFGIFVET
VEIGSKAAEAGLKRGDQIMEVNGQNFENITFAKALEILRNNTHLSITVKTNIFVFKELLC
RIGQEKNGIPHIPKIAEKKNNRYSIPDMPGDVEQMFPREKGNKKLKANTVSGGRNRIRKI
LDKTRFSILPPKLFSDGGVSQSQDDSIVGTRQCRHSLAIMPIPGTLSSSSPDLLQPTTSI
LDFSNPSAVGFYYIPDQVIRVFKADQQSCYIIISKDTTAKEVVSHAVNEFNLTGAPETYS
LCEVSVSPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETLCSDEDAQELLKESQI
SLLQLSTIEVATQLSMRDFELFRNIEPTEYIDDLYKLDSKTGNAHLKQFEDVINQETFWV
AMEILAEPNQLKRMKIIKHFIKIALHCRECKNFNSMFAVISGLNLAPVARLRGTWEKLPG
KYEKHLRDLQDLLDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDITFLHEGNDSKVDGL
VNFEKLRMIAKEIRQVVRMTSANMDPAVMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSS
LLNAKKLYEDAQMARKVKQYLSNLNVETDEEKIQILSLQCEPAYSTLTKNLSERRGAKSS
EMSPVPLRSIGQTTKAHQQNRMSQVLQVPSVNLYPSRKKGLTKDHVTFSTGSPQKSLSLS
EEVSSKKQTDDTMSMASSLHSSPPASPQGSPRKVGNIPRSDNCSQMNLSGSSSSLASETS
NKNSGQRSYGIGYALIPSTKSDNFSDSSHSEISSRSSIVSNCSVDSMSAALQDERSLSQS
LLVVDTAGMERKEHSQAEYGQPCPGWSVTRPALIRGMAFTSSMSNEEISHEHITVEAADS
GRGSWTSCSSSSHDNFQNIPNQKSWDLLNSYRHTQLDGPIAEVDPTNCYSEEAYLYSEAF
AKNNRQSKASTELDQSRQSWASSSSLSDTYETNYGTIKRRGLENSTSEQAEVLDSKPGTD
TAYKTVTSSTEKGLIVYCVTSPKKDDRYREPPPTPPGYMGISLADIKEGSPHHPHLKPPD
YSVAVQRSKMLHSDLSRLSSAPLGSDPVACIASKMPQWHSRQPSGPQLADMPGADSEEDE
DEQVSAV
Download sequence
Identical sequences ENSGALP00000039237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]