SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042807 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042807
Domain Number 1 Region: 703-1056
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.51e-94
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000869
Further Details:      
 
Domain Number 2 Region: 529-697
Classification Level Classification E-value
Superfamily ARM repeat 1.04e-57
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 110-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.39e-52
Family Ras-binding domain, RBD 0.0066
Further Details:      
 
Domain Number 4 Region: 328-491
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.03e-46
Family PLC-like (P variant) 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000042807
Domain Number - Region: 15-57
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0997
Family Ubiquitin-related 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042807   Gene: ENSGALG00000005505   Transcript: ENSGALT00000044047
Sequence length 1066
Comment pep:known chromosome:Galgal4:9:5092108:5132909:-1 gene:ENSGALG00000005505 transcript:ENSGALT00000044047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPAVTDSLDIWAVDSQIGADGSISVDFLLPTGIYINLDVPRDATISHIKQLLWKQAHTY
PLFHLLMEIDSYMFSCVNQTAVHEELEDETRRLCDVRPFLPVLKLVTRNCDPGEKLDSKI
GVLIGKGLHEFDALQDPEVNDFRAKMRRISEEKIQSLVGLSWMDWLKHTYPPEQEPVVPE
NFQDKLYSGNLVVAIHFDNCQDVFSFQVSPNMNPIKLNELAIRKRLTIHGKEDEEIDPAD
YVLQVSGRLEYVFGDHPLIQFQYIHNCVMNRTLPQLTLVECCTIKKMCEQEMIAIEVAIN
RKSSNLPLPLPPKKTRATTSVWDICSPFKIVLLKGNKLNTEENAKVHVRAGIFHGTELLC
KTIVSTEISGRSDHAWNEVLEFEINVCDLPRMARLCFAVYAVMDKMKTKKSTKSMNPSKY
QTIRKAGKVHYPVAWVNTMVFDYKGQLKNGEFVLHSWSSFPDELEEMLNPMGTVQTNPYT
ENATALHIRFQEYSKQPINYPPFDKILEKAAEIARSSDNAAMAGRGGKKFYIVLKEIMER
DPLSQLCENEMDLIWTLRYDCRENFPQSLPKLLLSLKWNKLEDVAQLQALLQIWPKLLPR
EALELLDFNYPDQYVREYAVGCLKQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERA
LANRRIGQMLFWHLRSEVHIPAVSVQFGLILEAYCRGSVAHMKVLAKQVEALNKMKTLNS
LIKLNAMKQSKAKGKDAMHTCLKQNAYREALSDLQSPLNPSVILSELHVEKCKYMDSKMK
PLWIVYNNKMFGGDLVGIIFKNGDDLRQDMLTLQILRLMDVLWKEAGLDLRILPYGCLAT
GDHSGLIEAVSSSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNLGDDLDRAIEEFTLS
CAGYCVATYVLGIGDRHSDNIMVRKNGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDF
IHVIQQGKTGNTEKFGRFRQYCEEAYLILRKHGNLFITLFALMLTAGLPELTSVKDIQYL
KDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
Download sequence
Identical sequences Q5F4A2
ENSGALP00000008740 NP_001026482.1.86415 XP_015132394.1.86415 XP_015132395.1.86415 XP_015132396.1.86415 XP_015132397.1.86415 XP_015132398.1.86415 XP_015132399.1.86415 XP_015132400.1.86415 XP_015132401.1.86415 XP_015132403.1.86415 9031.ENSGALP00000008740 ENSGALP00000008740 ENSGALP00000042807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]