SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000042975 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000042975
Domain Number 1 Region: 139-202
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000405
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000042975
Domain Number - Region: 51-122
Classification Level Classification E-value
Superfamily Tropomyosin 0.00177
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000042975   Gene: ENSGALG00000026922   Transcript: ENSGALT00000044711
Sequence length 226
Comment pep:novel chromosome:Galgal4:2:539156:543542:1 gene:ENSGALG00000026922 transcript:ENSGALT00000044711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEWAPAQDLEWAMEPQELSLEQPLAAPEEGPGREAELPAAEISVTLVTEVQAVDRKVEA
QAAQLMNLEGRMRMAESKLIGCERTAVEFGNQLESKWTALGTLIQEYGQLQKRLENMENL
LKNRNFWILRLPPGAKGEVPKVPMAFNDTSFSFSEDEWKNLNEWQKELYRHIMKGNYEAV
ISMDTDTAISKPDLLSRIEQGEDPNAEDQDDSEGGETPTDPSTGET
Download sequence
Identical sequences ENSGALP00000042975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]