SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397693778|ref|YP_006531658.1| from Pseudomonas putida DOT-T1E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397693778|ref|YP_006531658.1|
Domain Number 1 Region: 5-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 9.42e-29
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397693778|ref|YP_006531658.1|
Sequence length 181
Comment cytochrome B561 [Pseudomonas putida DOT-T1E]
Sequence
MVSSNPATHYARLSIALHWLMLVLLAAVYALIELRGLFPKDSVERNLMKDLHFMLGLSVF
VLVWLRLAMRLSRPTPPIVPKPPAWQTGLAHLMHLALYLMMIGLPLAGWLILSAADKPVP
FFGLELPHLIGPNPDQAKFIKGWHERIGSWGYWLIGLHALAGLYHHYVQRDNTLLRMLPY
K
Download sequence
Identical sequences A0A168X132 A0A173HCG7 A0A1Y5KSF8 A0A2I0C649 A0A2K4L9W4 A5W6U6 I3UQG3 I7BRV5
gi|395444596|ref|YP_006384849.1| 351746.Pput_3732 WP_003247218.1.100978 WP_003247218.1.1079 WP_003247218.1.25319 WP_003247218.1.33269 WP_003247218.1.33725 WP_003247218.1.35996 WP_003247218.1.44137 WP_003247218.1.45427 WP_003247218.1.5613 WP_003247218.1.60844 WP_003247218.1.74642 WP_003247218.1.75189 WP_003247218.1.78345 WP_003247218.1.96951 gi|397693778|ref|YP_006531658.1| gi|148548938|ref|YP_001269040.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]