SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397694421|ref|YP_006532302.1| from Pseudomonas putida DOT-T1E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397694421|ref|YP_006532302.1|
Domain Number 1 Region: 3-174
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.88e-31
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397694421|ref|YP_006532302.1|
Sequence length 177
Comment cytochrome B561 [Pseudomonas putida DOT-T1E]
Sequence
MKPQAFHPFARVLHWLMAVLILAMLFIGVSMVADLSLRHPVLISLHKATGLALLVLVVLR
IAVRLTLPHPPLPNDLPKLQRWAAGASHLLLYGLMLAMPLLGWAMLSAGDYPRPLGLPAI
APHNLQLYAVLRQAHGWAGYLLFATVLVHVGAALMHAWVRRDGVLRSMWPGPLHRSE
Download sequence
Identical sequences A0A160IZ67 A0A173HEH9 A0A1Y5KXV9 A0A2I0CGQ5 A0A2K4LB33 A5W476 I3V377 I7AXU6
WP_003248038.1.100978 WP_003248038.1.1079 WP_003248038.1.11138 WP_003248038.1.25319 WP_003248038.1.33269 WP_003248038.1.33725 WP_003248038.1.35996 WP_003248038.1.44137 WP_003248038.1.45427 WP_003248038.1.5613 WP_003248038.1.60844 WP_003248038.1.74642 WP_003248038.1.75189 WP_003248038.1.78345 WP_003248038.1.89748 WP_003248038.1.96951 gi|395449060|ref|YP_006389313.1| gi|148548018|ref|YP_001268120.1| gi|397694421|ref|YP_006532302.1| 351746.Pput_2804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]