SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397696238|ref|YP_006534121.1| from Pseudomonas putida DOT-T1E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397696238|ref|YP_006534121.1|
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 5.41e-53
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.0000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397696238|ref|YP_006534121.1|
Sequence length 218
Comment formate dehydrogenase, gamma subunit [Pseudomonas putida DOT-T1E]
Sequence
MNDNKPILRYNANERSNHWVVAILFILAGLSGLALFHPALFWLSNLFGGGPWTRILHPFI
GVAMFVFFLGLVLRFWRANFITANDRLWLRRVDRVMRNEEEGVPPIGKYNAGQKLLFWTL
LVCMLVLLVSGVVIWRAYFSHWFGIDVIRLSALLHALAAFVLILSIIVHIYAGIWIKGSI
GAMLHGWVSRAWARKHHELWYREVTGDKTPGDHGRKEG
Download sequence
Identical sequences A0A160ITJ6 A0A1Y5LCY6 A0A2I0CDI1 I7BYS4
WP_003255435.1.11138 WP_003255435.1.25319 WP_003255435.1.33269 WP_003255435.1.44137 WP_003255435.1.45427 WP_003255435.1.60844 WP_003255435.1.75189 WP_003255435.1.78345 WP_003255435.1.89748 gi|397696238|ref|YP_006534121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]