SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397697391|ref|YP_006535274.1| from Pseudomonas putida DOT-T1E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397697391|ref|YP_006535274.1|
Domain Number 1 Region: 26-201
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.34e-28
Family Clp protease, ClpP subunit 0.047
Further Details:      
 
Domain Number 2 Region: 373-440
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000101
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397697391|ref|YP_006535274.1|
Sequence length 448
Comment hypothetical protein T1E_4653 [Pseudomonas putida DOT-T1E]
Sequence
MIARCWRWLLLLLLLGITPGGQAAPGAVWVLGIDDAIGPASADYLVRSLSQAQAQGAQLV
VIRMDTPGGLDSAMRQMIKAILASTVPVASYVAPSGARAASAGTYILYASHVAAMAPGTN
LGAATPVRIGGPPGTPSDDKAKGGDDETLARKQVNDAAAYIRGLAQMRGRNADWAEKAVR
EAVSLSANEALRLNVIDQVADDLPDLLRELDGKTLQVAGQPRQLQTAGASVVEHLPDWRT
RVLAVITNPSVALILIMIGVYGLLFEFMNPGSAVGGVVGGICLLLALYALQLLPVSFAGV
ALILLGITFMIAEAFLPSFGVVGFGGIVAFVVGALILIDTDAPGFGIPLALIGTLALLSA
LLIGGVLGMALKARRRALVSGDAGLVGSLVTVTQVMASDPFCGVVLAQGEQWQVQCATPL
QTGQNVRVTARHGVMLEVSAAAPATQGE
Download sequence
Identical sequences I7B5S2
gi|397697391|ref|YP_006535274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]