SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000035841 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000035841
Domain Number 1 Region: 120-222
Classification Level Classification E-value
Superfamily TAFH domain-like 2.09e-39
Family TAFH domain-like 0.00000134
Further Details:      
 
Domain Number 2 Region: 512-554
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000131
Family MYND zinc finger 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000035841
Domain Number - Region: 446-520
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0034
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000035841   Gene: ENSGALG00000015926   Transcript: ENSGALT00000036630
Sequence length 604
Comment pep:known chromosome:WASHUC2:2:129794078:129902410:-1 gene:ENSGALG00000015926 transcript:ENSGALT00000036630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISVKRNTWRALSLVIGDCRKKGNLEFCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPP
TTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGA
RQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPF
VIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENG
KRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHY
RLDDMAIAHHYRDSYRHPNHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHL
LNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGNSSSSHSRQQSPVN
PDPVTLESHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMAELQKAVSEAERKAHDMIT
SERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQ
HKDWEKHHHICGQTLQAQQQGETPAVSSSVTPSSGAGSPIDTPPAATPRSTTPGTPSTIE
ATPR
Download sequence
Identical sequences A0A1D5PBA3
ENSGALP00000035841 9031.ENSGALP00000025624 NP_990075.2.86415 XP_015138256.1.86415 ENSGALP00000035841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]