SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000038112 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000038112
Domain Number 1 Region: 112-215
Classification Level Classification E-value
Superfamily TAFH domain-like 7.32e-40
Family TAFH domain-like 0.00000161
Further Details:      
 
Domain Number 2 Region: 498-539
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000593
Family MYND zinc finger 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000038112
Domain Number - Region: 431-480
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0366
Family Apolipophorin-III 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000038112   Gene: ENSGALG00000006234   Transcript: ENSGALT00000038902
Sequence length 590
Comment pep:known chromosome:WASHUC2:11:20497516:20504583:-1 gene:ENSGALG00000006234 transcript:ENSGALT00000038902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGTPRLEGHPFSKTGPDPAAPGAATMPDSPADVKTQPRSTPPNMPPPPPAVTQGATRH
PSFTPSTMMNGSSHSPTAINGAPSTPNGFSNGPATSSSASLSTHQLPPACGARQLSKLKR
FLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHAKLQEATNFPLRPFVIPFLKAN
LPLLQRELLHCARMAKQSPAQYLAQHEQLLLDANASSPIDSSELLLEVSESGKRRTPDSA
QEDGLDRDPLPPEHLRKDPFCPWRKQARTLSGLSHPPNGRAQPPGPPPETNRLFEMNLLH
QYRNVYRYADPSAPYGFAHGKRCRNIQLHWSGYMYIEQLTAMPQNLLNCIMDMVEKTRRS
LTVLRRCQEADREELNHWIRRYSDAEDMKKGSPPSARPHNSSSSSEAPQLDVHRDFVPRP
LSGYMPEEIWRKAEEAVNEVKRQAMSELQKAVSDAERKAHELITTERAKMERALAEAKRQ
ASEDALTVINQQEDSSEDACWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHVCGQTL
QGLPAPSVPTAVGQPEAVPLMASSPSDAGSGGASHAGTPGTPAPLESASR
Download sequence
Identical sequences 9031.ENSGALP00000038113 ENSGALP00000038112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]