SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000001068 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000001068
Domain Number 1 Region: 523-555,672-747
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000188
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000001068   Gene: ENSGALG00000000745   Transcript: ENSGALT00000001070
Sequence length 807
Comment pep:known chromosome:WASHUC2:26:2131520:2143284:-1 gene:ENSGALG00000000745 transcript:ENSGALT00000001070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHARPRYAIERPAYSVSLFDEEFEKKSRSYPVGEKLKNLFRCSASRFKLILFSLFPILV
WLPKYKIKEYILPDVLGGVSAGTIQVPQGMAFALLANLPPVNGLYSSFFPLITYLFLGGI
HQMVPGTFAVISIIVGNVCHELAPESDFQYFNYTTNETSVNTTAMEAARLEISATLACLT
AIIQLCLGFVQFGFVAIYLSESFIRGFMTAAGLQILISVLKYVFGLTVPSYTGPLAIVYT
FIDICKGLPKTNVASLVYALISAVLLIIVKELNLKYMKKIRMPIPMEIIIVIVATAISGS
FKMPEKYNMPVVGKISMGFPEPTLPLVSKWKDMIGTAFSLAIVSYVINLAMGRTLAAKHG
YDVDPNQEMLALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQQVASFCVALVVMVTM
LSLGIYLEPLPKSVLGALIAVNLKNSLKQLADPFYLWKKSKLDCLVWLVSFLAAFFLSLP
YGVAVGVGFSVLVVVFHTQFRNGSALGQVASMDIYKNPKAYNKVQELNGIKIVTYCSPLY
FANSEIFREKIIAKTGVDPGKVYLARKKYVKWQEKGRAQPSTKPPKFLLRQNKTLSLQEL
QKDFESASPTDTNNNQTTANGASISYITFYPPANGAGQVHTSSELGSTTTLQGSTFRVTS
TADVDPMATAPPYVSFHTIILDMSGVCFVDLMGTKALGKLCSSYQKIGIKVFLANVHAQV
YNDISTGGVFEEGGLDRKHIFLTIHDAVLFALANIKEVVHPPILEERPNQTELSIYDESV
DESSSEFMNLEEEMFGSMFHSETQTAL
Download sequence
Identical sequences ENSGALP00000001068 9031.ENSGALP00000001068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]