SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000001235 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000001235
Domain Number 1 Region: 485-513,633-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000314
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000001235
Domain Number - Region: 97-110,195-393
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0034
Family Calcium ATPase, transmembrane domain M 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000001235   Gene: ENSGALG00000000844   Transcript: ENSGALT00000001237
Sequence length 747
Comment pep:known chromosome:WASHUC2:26:121000:134800:-1 gene:ENSGALG00000000844 transcript:ENSGALT00000001237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFSWESFKKIIYKRFPVLNWLFSYQFREWILKDLHAGLNVGLVQVPQGLLGIWLAGLPLP
MINGFLSAFCCSMLYMVFGSSHHISIGSFSILNLVVKNILKSLDLNKTLSFNSSLVNFSD
PILLKDYMEILTLTASVTFMTGIIQLLLGCFCLKSVTAYLPKALIDAYLSAAALLVIVSQ
FTFIFDVVLDFHRSSRDIFCNVFYYFLALPKSNATSILVFLLSMAILQISKTIRITYMHS
PVAFPMELLLIITATIIANCIHLHAESSSAVVSRIPQRFLPPTLPDLSNLSKIILHAFSL
ATVSCFLLVFIGEKYALLHNYNISSSQELIAVGLCNICSAFFRSFAVSCAISGTVIQEKT
GGRTQIAALMGASIMLVIALKLGHFFWVIPNSVLAAIVVFNVLPFLEKFLDIPTLWRKDK
YHLAIWVGTFAAVLRLGLDIGLLIALAIAFFIISIRSHRMRMVELGQIPNTNIYRSLSIC
RAAVEIDGVKIFQCCSSISFANMNNFKNYLLHKMDMKTVPLNPHEMRALVSASLSDTSVA
SKDFKCSCVCDPPLPPPRIPYTEKLVKSCHIDSTSTSSSVNLVRWSKYGVRQNHGMLLLG
AANAKSASPGINTQLQPEKNEDEEQQTGVSLGSAVGPVHTIILDFSMVQFVDLQGSDLLR
QIFHMFFNIGITVLIAGCHSSVIAAFEKNEFFDSFVTKEMFFLTLHDALLAALAKHQKPD
ERELTTEENAEKLRAKDEMVEYLAYMK
Download sequence
Identical sequences ENSGALP00000001235 9031.ENSGALP00000001235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]