SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000002046 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000002046
Domain Number 1 Region: 378-513
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.43e-37
Family cAMP-binding domain 0.000000224
Further Details:      
 
Domain Number 2 Region: 111-286,317-377
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.23e-31
Family Voltage-gated potassium channels 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000002046   Gene: ENSGALG00000001342   Transcript: ENSGALT00000002048
Sequence length 747
Comment pep:known chromosome:WASHUC2:28:2177849:2190021:1 gene:ENSGALG00000001342 transcript:ENSGALT00000002048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGSPNGECRRGETPRSPSAEQPREPKVSFSCGGGGGGGGGGSASPGGAKAAEEGDDAGEE
VRGSQASFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYW
DFTMLLFMVGNLIIIPVGITFFKEETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNTE
IILDPERIKKKYLKTWFVVDFVSSIPVDYVFLIVEKGIDSEVYKTARALRIVRFTKILSL
LRLLRLSRLIRYIHQWEEQFHPSYGPFVPTSYACAACKRNLLEALCTDPGGVPVPQTIPP
LSKHNSGRTLLLPGKQNDSWSELYSFALFKSMSHMLCIGYGKQAPESMTDIWLTMLSMIV
GATCYAMFIGHATALIQSLDSEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQP
GDYIIREGTIGKKMYFIQHGVVSILTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTY
CRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLNSGVFNNQE
NEIIQEIVKYDREMVQQAELQQHTAMYSPVQPQVTSAIATLQQAVAMSFCPQMASPLVGS
MALGSPRMMRRLQYAQAVPSPFAVSPAAAAEPPAAAAAPRAPRQPIALAGPGTARLTQAL
PTSSFSQDSRPLSASQPSLPHGLAAGSTQSPPASVHESSASIGGGPAATAVSPGSGPPAQ
DSAAARKDSVGSMPDTDPAKSRLSSNL
Download sequence
Identical sequences 9031.ENSGALP00000002046 ENSGALP00000002046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]