SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008385 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008385
Domain Number 1 Region: 1-194
Classification Level Classification E-value
Superfamily DAK1/DegV-like 1.33e-57
Family DAK1 0.0000279
Further Details:      
 
Domain Number 2 Region: 221-421
Classification Level Classification E-value
Superfamily DhaL-like 1.83e-52
Family DhaL-like 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008385   Gene: ENSGALG00000005227   Transcript: ENSGALT00000008399
Sequence length 425
Comment pep:known chromosome:WASHUC2:5:321735:325011:-1 gene:ENSGALG00000005227 transcript:ENSGALT00000008399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVGDDCAFASQKKAGRRGLCGTVLVHKVAGAMAEAGASLDEIVTRVSAVTKAMGTLGLSL
SPCSVPGSKPTFQLASDEMELGLGIHGEAGVRRMKVMPADEAVETMLAHMTDPSNASHLP
LSPGASVVLVVNNLGGLSCLELSIVAGVAVRSLERRGVCIARALVGSFMTALEMAGISLT
LLLVDEELLRLIAAMAWPNVVTGPATCPETRGGSTKGGPGMERAQKVLARVCSTLLGLQD
KLNELDRAAGDGDCGHTHARAARAIQEWMRAQPLPPSPAHLFSALADLLLDKMGGSSGVL
YGLFLTAAAHPLHNRSDLPAWADAVDAGIEAMQRYGGAAPGDRTMLDALCAAAQALRALR
SPGADLLTVLASAVESAEAAAESTRHMEAGAGRASYISSAQLLQPDPGAVAAAAVLRAVL
EGLQG
Download sequence
Identical sequences 9031.ENSGALP00000008385 ENSGALP00000008385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]