SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008620 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008620
Domain Number 1 Region: 347-448
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 79-144
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.31e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 163-217,245-264
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.82e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008620   Gene: ENSGALG00000005378   Transcript: ENSGALT00000008634
Sequence length 633
Comment pep:known chromosome:WASHUC2:5:8502153:8522873:-1 gene:ENSGALG00000005378 transcript:ENSGALT00000008634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPDPADLISSSLSTSGVDCNRKRKGSSTDYQLDGFPFEEGMDTD
KDDQHGRLDYADQQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLT
VLRMAVQHMKTLRGATNPYTEANYKPAFLSDDELKHLILRAADGFLFVVGCDRGKILFVS
ESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDIT
PGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPP
TKMGLDEDNEPDNEGCNLSCLVAIGRLHPHVVPQPVNGEIRVKPTEYVSRHAIDGKFVFV
DQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSF
ITLRSRWFSFMNPWTKEVEYIVSTNTVVSTSVLDSGDAAFPQLAASPHSMDSVLQAGEGG
PKRSHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDTS
SPGSKKILNGGTPDISSAGLLSGQIQDSSGYPYSDNSSILGENSHIGIDMIDNDQGSSSP
SNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences Q9I8T7
ENSGALP00000008620 NP_001001463.1.86415 XP_015141816.1.86415 XP_015141817.1.86415 XP_015141819.1.86415 ENSGALP00000008620 9031.ENSGALP00000032095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]