SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009247 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009247
Domain Number 1 Region: 517-637
Classification Level Classification E-value
Superfamily EF-hand 0.000000219
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 2 Region: 271-328,366-490
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000022
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009247   Gene: ENSGALG00000005766   Transcript: ENSGALT00000009261
Sequence length 710
Comment pep:known chromosome:WASHUC2:6:18603988:18615476:1 gene:ENSGALG00000005766 transcript:ENSGALT00000009261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGLWGTTLTENTAENRELYVKTTLRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELF
LQTSSDSRVSFQSIGSMADFWVYAQGPLLDNLYWTKWYNNESLAAHNTQSYIYYENLLLG
VPRMRQLKVKNNSCVVHDDFKEEISGCYDVYSEDKEEKVSFGLINGTAWRYHSEEELGGS
SHWGRLTSYSGGGYYIDLKLTREESAEALQILKEKLWLDRGTRVVFIDFSVYNANINLFC
VLRLVVEFPATGGAIPSWQIRTVKLIRYVSAWDFFIVACEIVFCVFIFYYVVEEILELRI
HRLQYFTSIWNILDVVVILLSIVAIGFHIFRTIEVNRLLGELLKHPETYADFEFLAFWQT
QYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGY
LLFGTQVENFSTFVKCIFTQFRIILGDFDYNSIDNANRVLGPVYFVTYVFFVFFVLLNMF
LAIINDTYSEVKEELSSQKDELQLSDILKQSYNRTLMRLKLKKEQISDVQKALQNGTKEL
GFEDFKNSLKELGHADHEITAAFSRFDKDGNYVLDEEEQQQMKHDLEAKRVALNTEIENL
GKSYGGNNLDENLSYVEAKNNYANKASWVSKEEFQVLLQRVLLLEQSIHSIGSKIDAVVS
KLEVLERNKLETKDLMGKPLDNGRKEEEPSQEELLSQSLDQLGKEAAEGW
Download sequence
Identical sequences ENSGALP00000009247 9031.ENSGALP00000009247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]