SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000012971 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000012971
Domain Number 1 Region: 538-569,650-724
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000549
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000012971   Gene: ENSGALG00000007998   Transcript: ENSGALT00000012986
Sequence length 779
Comment pep:known chromosome:WASHUC2:1:15775485:15796293:1 gene:ENSGALG00000007998 transcript:ENSGALT00000012986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVRAEEPLAELSHYVVARPIYNEAGFQEENERLPPPPPTLLERARAVCSCSRKKAFQ
ITKSFLPILEWLPNYRVKEWLVSDIISGVSTGLVATLQGLAYALLVAVPVGYGLYSAFFP
ILTYFFLGTSRHISVGPFPVVSLMVGSVVMSMAPDDNFLIAGSNATGTNGTEILIDTDAR
DAQRVLIASTLTFLVGILQVVFGVLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVLN
VSTKNYNGVLSIIYTLIETFENIGSTNIADLIAGLLTIFVCMVVKEINDRFKHKIPIPIP
IEVIVTIVATGISYAADLEKKYNAGIVKSIPRGFLPPEAPDVSMFSQMIAASFSIAIVAY
AIAVSVGKVYATKYDYAINGNQEFIAFGISNIFSGAFSCFVATTALSRTAVQESTGGKTQ
VAGIISAGIVLIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVLDVPRLWRQNKVDAII
WVFTCIASIILGLDLGLLAGLLFGLLTVVLRVQFPSWGGFGNIPGTDIYRKVKDYKNVVE
PEGVKILKFSSPIFYANIDGLKSSLKSTVGFDAVRVYNKRLKALRKIQKLIKKGKLKATK
NGIISEPGISNEAFETDEEPEDNEDLQVPTKEVEIQVDWNSELPVKVNIPKVPIHSLILD
FGAVTFLDIVAVRSIKTIIREFERIDVRVYFASYQDNLISQLERSAFFDDTVRKDMFFLT
VHDAVLYIRNQMAYSDNQDPIFEKISLMQESKEPIEFTETVRPADELDVQEEAMRRLAS
Download sequence
Identical sequences XP_425419.3.86415 ENSGALP00000012971 ENSGALP00000012971 9031.ENSGALP00000012971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]