SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000022780 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000022780
Domain Number 1 Region: 355-456
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.68e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 91-157
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 176-230,258-305
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000131
Family N-terminal PAS domain of Pas kinase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000022780   Gene: ENSGALG00000014096   Transcript: ENSGALT00000022820
Sequence length 624
Comment pep:known chromosome:WASHUC2:1:70297389:70333506:1 gene:ENSGALG00000014096 transcript:ENSGALT00000022820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAGVGSAEGAEEERRAVEENFPVDGNSCIASGVPSLMNPITKPATTSFNNSVVEIPRK
RKGSDSDNQDTVEVDGDPQKRNEDEEHLKIKDFREAHSQTEKRRRDKMNNLIEELSAMIP
QCNPMARKLDKLTVLRMAVQHLKSLKGSTSSYTEVRYKPSFLKDDELRQLILRAADGFLF
VVGCNRGKILFVSESVCKILNYDQTSLIGQSLFDYLHPKDVAKVKEQLSSSDVSPREKLV
DGKTGLQVHTDFQAGPARLNSGARRSFFCRIKCSRTTVKEEKECLPNPKKKDHRKYCTIH
CTGYMKNWPPSEVGVEEENDVEKNSSNFNCLVAIGRLHPYIVPQKSGEIKVKATEFVTRF
AMDGKFVYVDQRATAILGYLPQELLGTSCYEYCHQDDHNHLAEKHKEVLQNKEKVFTNSY
KFRAKDGSFITLKSQWFSFMNPWTKELEYIVSNNTVVLGHSESAEEQVSYGSQPAEGKGA
VKQSLVSVPGMSSGTVLGAGSIGTEIANEILELQRLHSSPPGELSPSHLLRKSPSPALTV
NCSNVPNKELIQLCPSEAEVLETSEQNQGAIPFPSNEPLLGGNSQLDFAICENDDTAMTA
LMNYLEADGGLGDPAELSDIQWAL
Download sequence
Identical sequences ENSGALP00000022780 9031.ENSGALP00000022780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]