SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000039582 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000039582
Domain Number 1 Region: 103-205
Classification Level Classification E-value
Superfamily TAFH domain-like 1.44e-39
Family TAFH domain-like 0.00000273
Further Details:      
 
Domain Number 2 Region: 492-533
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000192
Family MYND zinc finger 0.00033
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000039582
Domain Number - Region: 426-501
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.00068
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000039582   Gene: ENSGALG00000003096   Transcript: ENSGALT00000040383
Sequence length 585
Comment pep:known chromosome:WASHUC2:20:2199360:2213519:-1 gene:ENSGALG00000003096 transcript:ENSGALT00000040383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVTCPCSLCTVAGEKRVPVMPGSPVEVKIQTRSSPPNMPPLPPVNPGGPRPVSFTPTALP
NGMNHSPPTLNGAPSPPQRFGNGPASSSSSSLTNQQLPATCGARQLSKLKRFLTTLQQFG
NDISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELL
HCARAAKQTPSQYLAQHEHILLNTTSSPADSSELLIEVNGNGKRHSPDRRDDNSFEREPL
PTEPPAKRVCTISPAPRHSPALSIPMLNPGGQFHPTPPPLQHYTLEDIATSHLYRDPGKM
LEHREIRDRHGGLGLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAV
LRRCQEADREELNYWKRRCSEAEPRKAGGELGTARHSPGSSDSIGSDSLREFSSRSGPGY
VTEEIWKKAEEAVNEVKRQAMSEVQKAVAEAEQKAFEMIASERARMEQTIADAKRQATED
AFLVINEQEESTESCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRICGQSLHGHSK
GLALPAGRSAKGMDGVPSPSMEKSSAATSRSSTPASVTAIDTNGL
Download sequence
Identical sequences 9031.ENSGALP00000039582 ENSGALP00000039582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]