SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ATET_00400 from Aspergillus terreus NIH2624

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ATET_00400
Domain Number 1 Region: 212-292,354-426
Classification Level Classification E-value
Superfamily E set domains 0.000000154
Family Arrestin/Vps26-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ATET_00400
Sequence length 821
Comment | ATEG_00400 | Aspergillus terreus conserved hypothetical protein (822 aa)
Sequence
MTTAHVSLLQQDLSGSATPGAQIPSAAEHHFPLLSSILSSRSERRRSLGTSIVGTGTANF
ASEEFPKQHHRRGSLLRKLAGPRENAKRFLRLGTPVHPPSTPPAARPMYRARRPRPVSEI
VLSPDDAQMLASHSLGVGRMRSHSSSTSSASRPSAGVAPQPSDPAVPFPTLRNERIVATG
SGISVGIALTEPVLYLQGYDHNDPSTKKSAILRGQLHLKVTKSVKIKKISICFRGHAQTD
WPDGIPPKKLHHTDKKDLVTHGVMYFNHGDPVLIQNDYGAHFYQHAKPVTSTVGKDGPTT
ITRELFSKTGSNTSLHNSHMTGKDLKRLSLQANHQHSRSFGKNDSSPGAPAHPQRNYRMF
PVGDYLYSFEFPIDGSLPETIKTDLGFVRYDLEAIVERSGAFRPNLLGTLEVPVIRTPAE
GSLEQVEPIAISRNWEDQLHYDIVISGKSFPLGSQVPIAFKLTPLAKVECHRIKVYVTEN
IQHWTVDKSVHRFQPAKKVLLFEKRADSASTSAYPGSSMRVTAGGGIGYDQRAAAARGQE
FVDRNRTNLLGDLGRDAGVGPTEMEFNVQLPSCHEMKNRDESQRLHFDTTYENIQINHWI
KIVLRLSKVDERDPNKRRHFEISIDSPFHLLSCKATQANIYLPAYTSPNSDPVPPAQEYE
CGCPGAAVIPRPAPVRRVSPPTDPEDSPGGGHVSRSFTNGSGGLTRPPPVHLAQEAHERP
NDPAPRPMHLLRAPSFAPPAFEDVPPPPPLVTPPPEYTSIVGDNDREAVLEDYFSRLSCY
EEHADDARGRGRVDVPLTPGGRVNRSMDVPREWVRLEESAV
Download sequence
Identical sequences Q0D0Y4
XP_001210486.1.65242 ATET_00400 33178.CADATEAP00007830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]