SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ATET_00774 from Aspergillus terreus NIH2624

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ATET_00774
Domain Number 1 Region: 52-202
Classification Level Classification E-value
Superfamily E set domains 0.0000000273
Family Arrestin/Vps26-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ATET_00774
Sequence length 704
Comment | ATEG_00774 | Aspergillus terreus pH-response regulator protein palF/RIM8 (705 aa)
Sequence
MSVNSLPSQPSSSLLGRNRSSLSLLSRFRSQLGQRNRSIADYYIEPDDPWRSYFPGDTIT
GTVVLTVVRPVRITHLVVSLHGYVKVFKNTMPSGDVAPDMGFLGPGRGRRGAEYLGNGLA
TLFEDEVVLCGEGRLKEGIYKFRFEMSFPPYALPSSISFERGTISYMLTSTLTKPTTMNP
TLSCRRRVNLLENIDIAPFPAPKARVVTLEPVSKRSKSKAKGKSVSSDAGPDSASLGTSV
NGGDTRPPLSPAPSNACYRGDTLPIVITINHCKQVRSAHGIIVTLYRQGRIDLHPSIPIG
RTTEGKKPIYEDIYPRSRTGLGGLTIGTSRTSSVFRKDLTQTFAPLVVDPTNLTAVVKTS
IRIPEDAFPTITRTPGSMINFRYYVEVVVDLRGKLTSPERFLPRFNMVSSGSNFSPSGQV
LNPPDTSTNSITTSWAGNILDTDQIRREKGVVAVAFEVVIGTRDSHRRANRVERTDSTAA
GSDVPSSIEAPVLDGENNWPAESGVPISADEEHYAPDEYGFPQEPYYSEYADGVQQPYQS
LGDMVSAPQLEEPADEKARLRQAEQTLLPSQPPDEAVAGPSAEMAVPTAPVLPEDDHLQD
YQHVPSPTQNGISPAVMSAESVQTVVPGSSAAMLGESATAPVDDKQELERQRLMMEASAP
DEMDGGGHGESSAGPSAPVFHDDDDHQLVGGTAHGDEALPRYQR
Download sequence
Identical sequences Q0CZW0
33178.CADATEAP00007545 ATET_00774 XP_001210860.1.65242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]