SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ATET_03596 from Aspergillus terreus NIH2624

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ATET_03596
Domain Number 1 Region: 28-105
Classification Level Classification E-value
Superfamily ALDH-like 0.000000000000393
Family ALDH-like 0.0041
Further Details:      
 
Domain Number 2 Region: 95-149
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000766
Family TK-like Pyr module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ATET_03596
Sequence length 152
Comment | ATEG_03596 | Aspergillus terreus predicted protein (153 aa)
Sequence
MNFCPPRLPNGSPSAISQQTILSRASHSLPPEELSAAVVPAKKALPAWRATTIAPRQQIL
FRFTHLIKDSWDRLAASITLEQGKTFKDARGDVLRGPTLQPIELANLFRAMPNILYIRPG
DSEETASAWIVAIQAKRTPSIISTSRHTVFLK
Download sequence
Identical sequences Q0CRT8
XP_001212774.1.65242 ATET_03596 33178.CADATEAP00007387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]