SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339485425|ref|YP_004699953.1| from Pseudomonas putida S16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339485425|ref|YP_004699953.1|
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 8.63e-53
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339485425|ref|YP_004699953.1|
Sequence length 218
Comment formate dehydrogenase subunit gamma [Pseudomonas putida S16]
Sequence
MNDNKPILRYNANERSNHWVVAILFILAGLSGLALFHPALFWLSNLFGGGPWTRILHPFL
GVAMFVFFLGLVLRFWRANFITANDRLWLRRVDRVMLNKEEGVPPIGKYNAGQKLLFWTL
LVCMLVLLVSGVVIWRAYFSHLFGIEVIRLSALLHALAAFVLILSIIVHIYAGIWIKGSI
GAMLHGWVSRAWARKHHELWYREVTGDKTPGNHGRKEG
Download sequence
Identical sequences A0A059US27 A0A099MVD4 A0A0C1HSX7 A0A136QH92 F8G158 L0FFU1 V7D786 V9UVC9
WP_013970651.1.1643 WP_013970651.1.23948 WP_013970651.1.28354 WP_013970651.1.35335 WP_013970651.1.56258 WP_013970651.1.65739 WP_013970651.1.71677 WP_013970651.1.7288 WP_013970651.1.7435 WP_013970651.1.80759 WP_013970651.1.95946 gi|431800545|ref|YP_007227448.1| gi|568180047|ref|YP_008952563.1| gi|568185481|ref|YP_008957996.1| gi|339485425|ref|YP_004699953.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]