SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339486482|ref|YP_004701010.1| from Pseudomonas putida S16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339486482|ref|YP_004701010.1|
Domain Number 1 Region: 9-77
Classification Level Classification E-value
Superfamily Homeodomain-like 4.44e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0064
Further Details:      
 
Domain Number 2 Region: 86-190
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000445
Family Tetracyclin repressor-like, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339486482|ref|YP_004701010.1|
Sequence length 211
Comment TetR family transcriptional regulator [Pseudomonas putida S16]
Sequence
MQKEPRKVREFRRREQEILDTALKLFLEQGEDSVTVEMIADAVGIGKGTIYKHFKSKAEI
YLRLMLDYERDLNGLLHSADVDRDKEALSRAYFEFRMRDPQRYRLFDRLEEKVVKGNQVP
EMVEQLHSIRASNFDRLTQLIKGRISEGKLEDVPPYFHYCAAWALVHGAVALYHSPFWSN
VLEDQEGFFQFLMDIGVRMGNKRKRDPEPSN
Download sequence
Identical sequences A0A059UUV5 A0A099MVV6 F8FS60 V9UUK7
gi|339486482|ref|YP_004701010.1| gi|568186402|ref|YP_008958934.1| WP_013971583.1.23948 WP_013971583.1.28354 WP_013971583.1.35335 WP_013971583.1.56258 WP_013971583.1.65739 WP_013971583.1.7288 WP_013971583.1.80759 gi|568180971|ref|YP_008953505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]