SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339486524|ref|YP_004701052.1| from Pseudomonas putida S16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339486524|ref|YP_004701052.1|
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.61e-28
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339486524|ref|YP_004701052.1|
Sequence length 181
Comment cytochrome B561 [Pseudomonas putida S16]
Sequence
MVSSTPTTHYARLSIALHWLMLVLLAAVYALIELRGLFPKDSVERNLMKDLHFMLGLSVF
VLVWLRLAIRLSRPTPPIVPKPAAWQTGLAHLMHLALYLLMIILPLAGWLILSAADKPVP
FFGLELPHLIGPNPDQAKFIKGWHERIGSWGYWLIGLHALAGLYHHYVQRDNTLLRMLPY
K
Download sequence
Identical sequences A0A059UYS0 A0A0B5K8I1 F8FT90 V7D977 V9UX02
gi|568186445|ref|YP_008958977.1| gi|339486524|ref|YP_004701052.1| WP_013971622.1.1643 WP_013971622.1.23948 WP_013971622.1.28354 WP_013971622.1.35335 WP_013971622.1.56258 WP_013971622.1.65739 WP_013971622.1.80759 gi|568181014|ref|YP_008953548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]