SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339489260|ref|YP_004703788.1| from Pseudomonas putida S16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339489260|ref|YP_004703788.1|
Domain Number 1 Region: 7-279
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.57e-96
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000031
Further Details:      
 
Domain Number 2 Region: 282-397
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 9.37e-34
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339489260|ref|YP_004703788.1|
Sequence length 404
Comment cytochrome b/b6 domain-containing protein [Pseudomonas putida S16]
Sequence
MMSKFMDWIDARFPATKMWEDHLSKYYAPKNFNFLYFFGSLALLVLVNQIVTGVWLTMSF
TPSAEEAFASVEYIMRDVEYGWILRYLHSTGASAFFIVVYLHMFRGLLYGSYQKPRELVW
LFGMLIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGGDLTQWIRGDYLISGI
TLNRFFALHVVALPIVILGLVVLHILALHEVGSNNPDGVDIKKKKDENGIPLDGIPFHPY
YTVKDIVGVVVFLFVFCAVVFFFPEMGGYFLEKPNFEQANAFKTPEHIAPVWYFTPFYAI
LRAVPDKLMGVIAMGAAIAVLFVLPWLDRSPVRSMRYKGWISKLFLLVFCVAFVILGILG
VLAPTPGRTLLSQVCTVLYFAYFLLMPFYTRLEKTKPVPERVTG
Download sequence
Identical sequences A0A059V561 A0A0B5K7Y6 F8G599
2035969074 gi|339489260|ref|YP_004703788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]