SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339487729|ref|YP_004702257.1| from Pseudomonas putida S16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339487729|ref|YP_004702257.1|
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.05e-42
Family PA0094-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339487729|ref|YP_004702257.1|
Sequence length 155
Comment hypothetical protein PPS_2826 [Pseudomonas putida S16]
Sequence
MDYELQEGGIALPAGFEDRTVNMFVLGASVPAPLSITISRDTLLPDEALQAYVDRQVKML
TSKLRGYTRMGNKAVSLSATAPIAGIQIDAYYMNQGRPLYQRQAAFIISPGRALIFSTTA
QADFSAQQNQDWDNLLASFTPRAPSVTSAESGEQE
Download sequence
Identical sequences A0A059USU7 A0A099MZQ6 A0A0C1I7S7 F8FXL3 J8UT41 V7D7I2 V9V0W4
WP_003260502.1.1643 WP_003260502.1.23948 WP_003260502.1.28354 WP_003260502.1.35335 WP_003260502.1.56258 WP_003260502.1.65739 WP_003260502.1.7288 WP_003260502.1.7435 WP_003260502.1.80759 gi|568187760|ref|YP_008960373.1| gi|568182382|ref|YP_008955005.1| gi|339487729|ref|YP_004702257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]