SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339489414|ref|YP_004703942.1| from Pseudomonas putida S16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339489414|ref|YP_004703942.1|
Domain Number 1 Region: 4-342
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 6.67e-82
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.000000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339489414|ref|YP_004703942.1|
Sequence length 345
Comment transport system permease [Pseudomonas putida S16]
Sequence
MKQRVQPRTLFVCLGLLCLLAVWLSLALGPVSLPLFDTLRAGLRLLGLPIAADGLQQAEM
ILGQIRLPRTLLGLAVGAVLALSGVAMQGLFRNPLADPGLVGVAAGAAVGAAVAIVGGSW
LGGMPDVLAPYLLSLCAFIGGLGVTALVYRLGRRDGQTNVATMLLAGVAMTALGGAAVGL
FSYLADDATLRTLTFWNLGSLNGASYQRLWPLLLVAAGVAVWLPRRAKALNAMLLGESEA
RHLGIDVERLKRELVFCTALGVGAAVAAAGLIGFIGLVVPHLVRLLAGPDHRVVLPASLL
AGGALMLFADLAARLLLAPAELPIGIVTAFIGAPFFLFLLIRGRS
Download sequence
Identical sequences A0A059V2X5 A0A099N4D6 F8G6E2 V7D409 V9V6K9
gi|568184048|ref|YP_008956738.1| WP_013974263.1.23948 WP_013974263.1.28354 WP_013974263.1.35335 WP_013974263.1.56258 WP_013974263.1.65739 WP_013974263.1.7288 WP_013974263.1.80759 gi|568189421|ref|YP_008962101.1| gi|339489414|ref|YP_004703942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]