SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339489997|ref|YP_004704525.1| from Pseudomonas putida S16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339489997|ref|YP_004704525.1|
Domain Number 1 Region: 223-267,299-534
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.17e-47
Family CoA transferase alpha subunit-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339489997|ref|YP_004704525.1|
Sequence length 620
Comment acetyl-CoA hydrolase-like protein [Pseudomonas putida S16]
Sequence
MHLCSIDQAVEQVLSRLPAHIHMGLPLGLGKPNAFVNALYARIRELPERRLTIYTALSLG
RPPLGDGLQRRFLEPFVERVFADYEELTYLADLRNDSLPPNIQVEQFFMQPGSLLHSDSA
QQSYISSNYSLAARDINAKGLNLIAQLVAATPERPVHLSLACNPDITLDLLPMIAKRRAA
GETILMLGQVHAELPYMPGDAELPIDTFDLLIDTAEQRRLFSTPNMPVNTQDHCIGLHAS
SLVRDGGTLQIGIGAMGDAVAAALLARQGDNAGYRAVLDALGVGSWQALIEREGGLDTFA
QGLYGCSEMFVNGLLALAEAGLLRRPADEQVAAVLHGGFFLGPQAFYQRLRDMPLEQRAQ
FAMTRISFINELYGQEELKRRQRRDARFINSVFGMTLLGAGVADQLEDGRVLSGVGGQYN
FVAQGHALEGGRSILLLRSWREAGGEVTSNLFWNYGHCTIPRHLRDIVVTEYGIADLRGQ
TDSEVIARLLAVCDSRFQQGLIEQAKDAGKLAKDFQLEACFTDNTPQRLEAIRARHSRLF
PEYPLGTDFTAEERDLLRALNWLKSKFKLSEVLELGKAALDAPGPEGYARHLVRMQLDQP
QGLKEELYQRLLLAGLQAAK
Download sequence
Identical sequences F8FZI7
WP_013974776.1.56258 gi|339489997|ref|YP_004704525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]