SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|160951|estExt_Genewise1.C_1090146 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|160951|estExt_Genewise1.C_1090146
Domain Number 1 Region: 2-194,315-362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.18e-73
Family Tandem AAA-ATPase domain 0.000000644
Further Details:      
 
Domain Number 2 Region: 660-877
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.96e-58
Family Helical scaffold and wing domains of SecA 0.0000272
Further Details:      
 
Domain Number 3 Region: 364-472,559-654
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.22e-49
Family Tandem AAA-ATPase domain 0.00000689
Further Details:      
 
Domain Number 4 Region: 193-315
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 1.02e-41
Family Pre-protein crosslinking domain of SecA 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|160951|estExt_Genewise1.C_1090146
Sequence length 897
Sequence
MEGLSDEALRNKTGELKARVAAGESLDSVLPDAFAVVREASKRVLGLRPFDVQLIGGMVL
HKGQIAEMKTGEGKTLVAVLPAYLNALSGQGVHVVTVNDYLARRDAEWVGQIPRFLGLKV
GLIQQGMDSAERRTNYGSDITYVTNSELGFDYLRDNLALSPDDLVLPSFNFCVIDEVDSI
LIDEARTPLIISGPAEKPTDRYYKAAKIAAAFARDVHYTVDEKQKSVLITEEGYEAAEEI
LDVKDLYDPREQWASYVINAIKAKELFLKDVNYIVRGEDVLIVDEFTGRALPGRRWNDGL
HQAVEAKESLPVQNETVALASISYQNFFLQYPRLCGMTGTAATERSEFEKIYKLSVAVVP
TNRAMIRKDESDVVFRAVTGKWTAVVVEISRMHKAGRPVLVGTTSVEQSESLSKQLSEAN
IPHQILNAKPENVERESEIIAQSGRVGAVTLATNMAGRGTDIILGGNADFMSKIKLREML
MPKVVILSDDEIAFQKKKKIPTRKSWMANENLFPCKLSENSSSLAEAAVQAAVESWGKKS
LSELEAENRLSYACEKGPTEDAVVAKLRNAFQAISAEYKAYTEDERKKVVAAGGLHVIGT
ERHESRRIDNQLRGRSGRQGDPGTSRFFLSLEDTIFRIFGGERIKALMTAFRIEDLPIES
KMLTKSLDEAQRKVENYYFEARKQLFEYDEVLNSQRDRVYTERKRALLSKDLQPLMMEYS
QLTMDDILNANISDELPKEEWDLEGLASKVKQYCFLLDDLSVEVLLKNADTIESLREYLH
KRGREAYLEKRADVEKQAPGLMHEAERYYVLTQVDKLWKEHLQALKFIQQAVGLRGYAQR
DPLIEYKLEGYNLFLDMMARIRRNTIYCVYQFKPVMIDKETLDRSKSTKNGKTAATV
Download sequence
Identical sequences D8T4L7
jgi|Selmo1|160951|estExt_Genewise1.C_1090146 XP_002990503.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]