SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|170576|estExt_Genewise1Plus.C_120167 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|170576|estExt_Genewise1Plus.C_120167
Domain Number 1 Region: 145-229
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.44e-24
Family Middle domain of MutM-like DNA repair proteins 0.0035
Further Details:      
 
Domain Number 2 Region: 2-148
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.79e-23
Family N-terminal domain of MutM-like DNA repair proteins 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|170576|estExt_Genewise1Plus.C_120167
Sequence length 268
Sequence
MPELPEVEAARRAVELHCKGLICRASVADDTTVIEGMAPFDMQRRLVAKRIVAAHRKGKQ
LWLELDEPPSICFQFGMAGAVYVKGVKSTKYVRSAVKDEDEWPSKYSKVHLVLDTGVEMS
FTDKRRFARVRLIQDPRLSPPISELGPDAYTELPDETTFADSVAKKKTAIKAVLLDQSFI
AGIGNWIADEVLYQSRIHPEQPASTLTAIDCERLRGAIKEVVMTAVDVDADLERFPRDWL
FHHRWGKKPGSVNGEFPKSFNIAHMAGS
Download sequence
Identical sequences D8RDV2
jgi|Selmo1|170576|estExt_Genewise1Plus.C_120167 XP_002969230.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]