SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|176627|estExt_Genewise1Plus.C_360058 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|176627|estExt_Genewise1Plus.C_360058
Domain Number 1 Region: 2-197,318-365
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.04e-65
Family Tandem AAA-ATPase domain 0.000000461
Further Details:      
 
Domain Number 2 Region: 367-475,586-667
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.78e-44
Family Tandem AAA-ATPase domain 0.0000239
Further Details:      
 
Domain Number 3 Region: 200-318
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 4.97e-39
Family Pre-protein crosslinking domain of SecA 0.0000537
Further Details:      
 
Domain Number 4 Region: 835-938
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.96e-17
Family Helical scaffold and wing domains of SecA 0.0014
Further Details:      
 
Domain Number 5 Region: 674-792
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0000000000000222
Family Helical scaffold and wing domains of SecA 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|176627|estExt_Genewise1Plus.C_360058
Sequence length 942
Sequence
MKALSDKQLRAKTDYFRRRLAAGESLNDIQSEAFAVVREAGRRQLNMRHFDVQIVGGAVL
HDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVITVNDYLAQRDAEWMGQIYKFLGLSV
GLVKSSLEPEERKAAYACDITYGNNSEFIFDYLRDHTCSTKEEMVMRWPRPLHFAVVDEI
DSVLIDEGRNPFLLSSESSKNASRYPVAAEVADFLIVDRHYTVQQKQKTVELTEEGVAMA
ELALGIENLWDGKDPWARFVVTALKAKECYFRDVDYIVRDGKVQIVDEFTGRVATNRRWS
DGIHQAVEAKEGVKINPETVMSAHMTYQSYFKLYSKVSGMTGTAKTEEKEFLKLFNMPVV
EVPTNLPNIRVDLPLHIFPTARGKWRRVREEIEIMHAQGRPVLVGTTSVEESELLSALLH
EHNIPHNVLNARAKYAAREAEIVAQAGRKSAITIATNMAGRGTDIILGGNPEMLAKEILQ
RRILPFMASDSPDVETDGAPLSQKGLSTIKLSGVSFSRIFRACAAAKVVCGSGGEVFSYR
EAKDKLLYVFNNARFEDEDRLIDLASGSGAETLSLGPSIALACLSVLRDCRAYCLLEGNE
VKRLGGLHVIGTALHESRRIDNQLRGRAGRQGDPGSTRFMISFEDDMLQKYGGELAYKLM
KAVGVEDVDVGSGITRHQVLSIQTSVEKYFSGVRRHMVEYDAVLEVHRSHVFKLREAFVM
GTFDSCQQLFYQYIQGVADEMVLNHVDPTKPPRNWNLEGFLDEFDDFASVTFAFPRGSHL
LSNVTKETIVSALSTSRLMKELPGLPPTGLDAGDSPMKAASLSRWKRDDFLPSGRHCQEL
DSFRRYVGDILIAEYQRKLESIQEFREDANQVERSVAISALDYFWRMHLANMSRLSSAVQ
ITGFGHMNPLDEYKLDGARFFIKMLSAARRMTVESLLKPWAD
Download sequence
Identical sequences D8S3T1
XP_002977981.1.77236 jgi|Selmo1|176627|estExt_Genewise1Plus.C_360058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]