SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|186164|estExt_Genewise1Plus.C_1210048 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|186164|estExt_Genewise1Plus.C_1210048
Domain Number 1 Region: 10-232
Classification Level Classification E-value
Superfamily Hsp33 domain 3.14e-48
Family Hsp33 domain 0.0000204
Further Details:      
 
Domain Number 2 Region: 253-300
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.00000000249
Family HSP33 redox switch-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|186164|estExt_Genewise1Plus.C_1210048
Sequence length 302
Sequence
MALRCSASGNDQILRCVSKNAEVSVLSIVGKHLVQEAQRRHQTSPTASAALGRALLGTLL
VASLKDDAETVQISFLGRGPLGQMTTVASQSKLVKGFVSNPLCDLPLTPQGKLDVGTAVG
AGALNVVRNHPRWKQPYTGSTPIYSGEVAEDIARYLAESEQINTALGIGVAFSTQGTVKA
ARGYLVQALPFCSEETLTRLEKNVASMHSLSDPSLDMTAREMITRLLEGIGTDSFSDPVF
PEFGPCGVDDLKPRMIRAVASLGASDVRELLSENGYVEVKCEFCAETVRFVEEDLKEIFT
HS
Download sequence
Identical sequences D8T7K1
jgi|Selmo1|186164|estExt_Genewise1Plus.C_1210048 XP_002991558.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]