SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|266972|estExt_fgenesh1_pm.C_70008 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|266972|estExt_fgenesh1_pm.C_70008
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 2.35e-31
Family Sigma2 domain of RNA polymerase sigma factors 0.00024
Further Details:      
 
Domain Number 2 Region: 140-233
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 5.05e-17
Family Sigma4 domain 0.0025
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|266972|estExt_fgenesh1_pm.C_70008
Domain Number - Region: 75-145
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0379
Family Sigma3 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|266972|estExt_fgenesh1_pm.C_70008
Sequence length 249
Sequence
MILSNLRLVVAIARRYENMGVEIGDLIQEGTLGLIHGLEKFDVSRGFKFSTYAYWWIFQA
MIRSLDKRGKCVRYPFHLCEAIRKINQLRNRQVDDRPVSVETMMQVLKLPRARIEIALQA
SNYRLTSLDRHVANKRCFEEGDPLEDFIVDQNVENQPWLMAERDAVKEELDRLLESKLDA
REREVIRKRFGLHPNQTSPLSRHEIGRSCGISRERVRQLENDAMAKLRACKSRLSMEFLL
SSAYDTILW
Download sequence
Identical sequences D8R5F3
jgi|Selmo1|266972|estExt_fgenesh1_pm.C_70008 XP_002966114.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]