SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|404741|fgenesh2_pg.C_scaffold_2000729 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|404741|fgenesh2_pg.C_scaffold_2000729
Domain Number 1 Region: 97-213
Classification Level Classification E-value
Superfamily HAD-like 0.0000151
Family NagD-like 0.099
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|404741|fgenesh2_pg.C_scaffold_2000729
Domain Number - Region: 208-256
Classification Level Classification E-value
Superfamily Hsp33 domain 0.0471
Family Hsp33 domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|404741|fgenesh2_pg.C_scaffold_2000729
Sequence length 379
Sequence
MSSLKKDFSICWETLANPLYPMFFPLLLELGVDHLELQTSCFSKAVATVDPGLCRKGNCC
SVAISVGNFPRVVWFWRLYCVVTFLSRGPQGLDQRSDLDETLIRETENSKYVYHVANAFY
TPMHGSSEFLSVLNAIPNVQMHFFSSGRECRNIPLVQQIMEGCCLRCSYNIFSMSHMTKE
SGSWDYKKKLENLGFELPWTIMVDDESSGVAATGEEINFLQMYYFSQSEHLQDREVLRLR
RENSLIRALGLIIWALELSMIANCTLVQALVAIQWDQNGKYAHQRTNAIQVYDVGLAAMQ
KVNPNIVLLGCTNNAMVYPWSELKMDHHSNAHEKFWRIGFGKQKIDRLMMHRLQLDVSLP
AVKTRDVEEDLCIDALYCQ
Download sequence
Identical sequences D8QW89
XP_002963128.1.77236 jgi|Selmo1|404741|fgenesh2_pg.C_scaffold_2000729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]