SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|405630|fgenesh2_pg.C_scaffold_4000204 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|405630|fgenesh2_pg.C_scaffold_4000204
Domain Number 1 Region: 12-190
Classification Level Classification E-value
Superfamily Hsp33 domain 0.000000000000419
Family Hsp33 domain 0.00074
Further Details:      
 
Domain Number 2 Region: 226-260
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0000105
Family HSP33 redox switch-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|405630|fgenesh2_pg.C_scaffold_4000204
Sequence length 270
Sequence
MFLVFMRIFRPALMATLLLHAIEAAAENIKITIVGSGGPLGGITAIGSNTGLVKGYVDFP
RSDFPCLPNGLLDARGTLGERGNLTVTLHNSSWKRLKLFDTGVIGGLCNSREEIYRKESR
LILQKLLHSFASFGVFLDKQGTITCARGYVYQALPSVSKMTLDRMAKNTRDLPKWNINAD
EICELLFQGIGRRKTIRTINPRFGPCGLEMKQRILENEISSKGFWQIRQALKSKGYIEAF
CDACGEEYRFTEDELGELIGKSISDSEEEE
Download sequence
Identical sequences D8QZ71
XP_002964408.1.77236 jgi|Selmo1|405630|fgenesh2_pg.C_scaffold_4000204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]