SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|408785|fgenesh2_pg.C_scaffold_9000158 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|408785|fgenesh2_pg.C_scaffold_9000158
Domain Number 1 Region: 33-143
Classification Level Classification E-value
Superfamily Hsp33 domain 0.00000000000000157
Family Hsp33 domain 0.0005
Further Details:      
 
Domain Number 2 Region: 276-310
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0000131
Family HSP33 redox switch-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|408785|fgenesh2_pg.C_scaffold_9000158
Sequence length 320
Sequence
MALGELQRCWRSRSSGSDWFKLRSDPTLRIGERRVVSVTATSVVREAQRRFSTSRAATVI
LGQTLMATLLLHAIEAAAENIKITIAGSGGPLGGITAIGSNTGLVKGYVDFPRSDFPCLP
NGLLDARGTLGERGNLTVTLHNSSWKRLKLFDTGVIGGLCNSLEEIYQKESRLILQKLGS
FIPLLRLVFSLTSKEPSLVLEATFTSVSKMTLDRMAKNTRDLPKWNINADEICELLFQGI
GRGETIRTINPRFGPCGLEMKQRILENEISSKGFWQIRQALKSKGYIEAFCDACGEEYRF
TEDELGELIGKSISDSEEEE
Download sequence
Identical sequences D8R9Z0
XP_002967626.1.77236 jgi|Selmo1|408785|fgenesh2_pg.C_scaffold_9000158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]