SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|419810|fgenesh2_pg.C_scaffold_44000033 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Selmo1|419810|fgenesh2_pg.C_scaffold_44000033
Domain Number - Region: 92-204
Classification Level Classification E-value
Superfamily HAD-like 0.00014
Family NagD-like 0.064
Further Details:      
 
Domain Number - Region: 198-246
Classification Level Classification E-value
Superfamily Hsp33 domain 0.0432
Family Hsp33 domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|419810|fgenesh2_pg.C_scaffold_44000033
Sequence length 369
Sequence
MPQLAKTISGRTNVLYVSRRQWRQWIQDSVAKATVALLQFLLAISLELCGFGDFTASLLS
CLGGLRDLTKEVIQPSSYILFFIPAGKKTGYLDETLVRETEDSKYANAFYTPMHGSSEFL
SVLNAIPNVQMHFFSSGRECRNIPLVQQIMEGCCLRCSYNIFSMSHMTKESGSWDYKKKL
ENLGFELPWTIMVDDESSDVAATGEEINFLQMYYFSQSEHLQDREVLRLRRENSLIRALG
LIIWALELSMIANCTLVQALVAIQWDQNGKYAHQRTNAIQVYEAGLAAMQKVNPNIVLLG
CTNNAMVYPWSELKMDHHSNAHEKFWRIGFGKQKIDRLMMHRLQLDVSLPAVKTRDVEED
LCIDALYCQ
Download sequence
Identical sequences D8SAM2
XP_002980192.1.77236 jgi|Selmo1|419810|fgenesh2_pg.C_scaffold_44000033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]