SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|427155|fgenesh2_pg.C_scaffold_88000099 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|427155|fgenesh2_pg.C_scaffold_88000099
Domain Number 1 Region: 87-208
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.000000000107
Family N-utilization substance G protein NusG, N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 245-302
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000639
Family N-utilization substance G protein NusG, C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|427155|fgenesh2_pg.C_scaffold_88000099
Sequence length 311
Sequence
MDRVVRLDSFALALLRRPNAGIHAVASAVEHTDLTGRERRRQKNERRLELAASRKLPKPE
EEEKKKVDQRRKKKSDPSLANLAKMGMQWYTLRVFTNNEAESMEALRSTLEAEFPDAKFE
VWSPIIPTESVVRGKSRFAMKAMLRGHIFLRCVLEAPVYRHAMNERSVFCFVGAFPYKMK
AGYDTKMMKGGYPDARIPAPVPSYQIEALREEAATREREFKLEQQKKKASEDQVLLEVKE
VDDLEQRQGDLRVGDMVAVISGAYQNFQGTILEFLPAGKVKIVLPVFGTDTEIEVDMDAL
MFMVMKVILFI
Download sequence
Identical sequences D8SYP5
XP_002988471.1.77236 jgi|Selmo1|427155|fgenesh2_pg.C_scaffold_88000099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]