SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|428297|fgenesh2_pg.C_scaffold_100000069 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|428297|fgenesh2_pg.C_scaffold_100000069
Domain Number 1 Region: 301-362
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000731
Family PHD domain 0.02
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|428297|fgenesh2_pg.C_scaffold_100000069
Domain Number - Region: 530-563
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000102
Family Rho termination factor, N-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|428297|fgenesh2_pg.C_scaffold_100000069
Sequence length 590
Sequence
MGKRPFVLVYQSGNYVWSFDSNGEVELTPKSQFQATSLRPAKWHLINHKIEPSDALGKRV
LVAASPDPANVKNAYPDRHLAIVYLYPWDRDEFDALVKLWEEEASQLEKRASQLEMQQSC
ELQGCSLEETDNMMEDELKNTYEVQEREGDDADDKMIAENLREEARLIRIRVGVADTYYK
WFGGVPRKLWQIEPRLLTDIELERFVDTALFKTDVRAIAAGAESDDISWMLLHLKRPQAA
GYKYLIDFASPKIKYKFTSSIPTANRHDLIVLLDSTDPGLGALGGFLFEQDVVAKVLQSP
ISAVLMVDDKHCTKCNSRMDCGEGPVNWIACGVCKKWYHYLCVLETAPVPLKWRCASCEG
KPGDEVLTTTRRLRLRYYRGDLKEALFNAGAHAVNYVWRPLRKKNGSYDFAILPGTLGQA
TTAKYHPVPFEAIKGGLAALEAWNKEYNKEAYPERFLLSFFLSRDNYPDFGYQSYRNKQH
RVSNKGVRGIMQAKVLIQTLGDEQSQLCADIPEPEDSVEKLDELAFEPIDFQAMTMEQLR
TMARENGLSGYSSMRRQQLMEKLEALVIVDEDEDLEFESQYYSRVGALVS
Download sequence
Identical sequences D8T2D6
XP_002989712.1.77236 jgi|Selmo1|428297|fgenesh2_pg.C_scaffold_100000069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]