SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|429881|fgenesh2_pg.C_scaffold_121000039 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|429881|fgenesh2_pg.C_scaffold_121000039
Domain Number 1 Region: 40-255
Classification Level Classification E-value
Superfamily Hsp33 domain 1.22e-17
Family Hsp33 domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|429881|fgenesh2_pg.C_scaffold_121000039
Sequence length 474
Sequence
MQSEYNAQLENDAWSLVLRESIPTGTSIIKCFCSSSGSGDYILSCVSSSEEIEIHSVKAD
ALVREAQRTLQTSRMSSIVLGNAMMGSVLLSSIFPDANAITISTVCDGRLGFVHAATTFD
GFTTGHVHNLSHSSHGNMIMATVVRECDMRLSISLSKSHRTFVSPMGPSREVAESLAYFL
WKNQKMDTAASLAMKFDEHNIVKTARGFIIQVYPLSEKLACHQLRENIENSPSLADLDDT
DARDIIEKLLHGIEPGSFSQRDLKFQPVGEEERQRFLWQREKLFSSNQARTYEKMINNPT
SQDFEETKLPPQHPSDLYKLANGAFTSKIGTTRRGPRRPEIRMPRMVHTPSRERSFKRHG
GINEQEMTENGFEQRKSQGVDDTAVHGLHQWDDHEIICVVPHTQRIRVWNVVAVVGRSNS
MGYTALWLDLLSLFSVQCMQFVNRVTFSPWKRGFTNCTPPGNGVLAFKIITCNL
Download sequence
Identical sequences D8T7M4
XP_002991612.1.77236 jgi|Selmo1|429881|fgenesh2_pg.C_scaffold_121000039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]