SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|121498|e_gw1.65.194.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|121498|e_gw1.65.194.1
Domain Number 1 Region: 1023-1302
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.97e-43
Family Hypothetical protein VC1974 0.0033
Further Details:      
 
Domain Number 2 Region: 7-188
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.03e-39
Family Pyruvate oxidase and decarboxylase Pyr module 0.0015
Further Details:      
 
Domain Number 3 Region: 781-981
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.17e-38
Family D-glucarate dehydratase-like 0.001
Further Details:      
 
Domain Number 4 Region: 463-615
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.68e-18
Family Pyruvate oxidase and decarboxylase PP module 0.012
Further Details:      
 
Domain Number 5 Region: 639-753
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.00000000000123
Family Enolase N-terminal domain-like 0.0043
Further Details:      
 
Domain Number 6 Region: 170-180,225-381
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0000000277
Family Pyruvate oxidase and decarboxylase, middle domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|121498|e_gw1.65.194.1
Sequence length 1309
Sequence
SKQLKDAANINMLWARLLVDECCRLGVTYFCVAPGSRSSPLAEAAAANPRVTCISCVDER
SLGFYALGYGRGARRPAAVVITSGTAMSNLLPAVVEASQDCVPLLILSADRPHELRDVGA
NQSINQVKHFGSFVRFDFDLPPATDEVPARMVLTTLDTAIFRATTDPYGPVHVNCPFREP
LEAVRAEWDLECLEGLSQWMASASPFTTYIPSSTSSLLDGTATLYTGSQMKEVSSLIASA
SRGVIVAGGLNQSQTTWAVFKLAKHLRWPLVPDVLSGLRLASKEEDMDVKIIHNLDHVLL
NPSLHPSVAPDIILQIGSRITSKRLSQFLQECSPRAYILVEEHPYRHDPGHRLTHRIKSS
AGEFARFVMKELTEPEFPERCHSYGMWLHVLSDTVRREILFQLQAEATLTEPCIARIVSS
SITTESAVFLGNSMPIRDVDMYADGLTDQQSLLGDQNLPAMVSIGANRGASGIDGVISTA
VGFAAGSNKRVTLLIGDLSFLHDTNGLMFLMGREAQPPVTLVVVNNRGGGIFSLLPAAGL
MPAVAFRNLISSEHDVHLDKLCHAHRINHILVQSKAELVRALQDSRTSTSSWVIEVASNI
QKNANFHRFLQQAIHCHLDRVLPVLSRHVSADKKIIVAVETSPYSFPLTSRLTTGAAEFY
RQGFLLRLVLNNGFSGYGEVAPLPGVHEEGLLDVEMQLSVLCGKLTGVELPENVALLDGS
FSQWLRTNLGPQAETIFPSVRCGLEMAALEALAASHNCSLLSVCNGRPSDVSICGLIDMS
EGTPDDVASVAEQLVHEGFTTLKMKVARRALPTQDAAVVVAVRQRVGRGIHLRVDANRRW
TLSQAVQFAEAVRECDIQYLEEPVNNHASLPAFLEQTQVRVALDETIDLNLSCFEKVLES
APLGNIVAAVIKPGRLGGFENAYMLCRLSLNHNIRPVISACFESSLSLAAYAQFAAFVDG
QSPLPSVAHGLGTYAWIERDAVGRSFSSIVNKGIVSAGAVNAVASTLLQFSPPKPRARSF
TSTVALGGYCFTFRVVEVASMRQEKQTVVFLHGFLGSAEDWLPVMHSLASSFRCLAVDLP
GHGRASSVTGNLEAEWGLDVLSAALSELLEQLSEGSEIVLAGYSMGARIALYMALHKHQK
IRAAVIVSGSPGLRDKQARIIRATQDDSLALSLRLGGLDNFVVNWYKRPLWKSLRHHPDF
KNLIASRLEMHKGNEVALAGALSQLSVGRQPCLWEQLHTANIPLLVVVGKADEKFVRIAS
EMVYAFKTFGKGNALKVVQIDGSGHCVPIESPLLLVQALHSFMLGVGLN
Download sequence
Identical sequences D8SNN4
XP_002985035.1.77236 jgi|Selmo1|121498|e_gw1.65.194.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]