SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|135647|e_gw1.138.58.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|135647|e_gw1.138.58.1
Domain Number 1 Region: 249-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000014
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 2 Region: 65-191
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000353
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|135647|e_gw1.138.58.1
Sequence length 577
Sequence
MQSPSIAASSCTSAGGGACGGVLAATPNDGSGSGGLEEDQLQAWVGLNKLGQDLEGLVTS
AEDCHFYSDAEIIVAEGVTVPVHRCILAARSPFLRRIFAEKQREQQRVDLAELAGGTGKI
GRQALMIVLGYFYGGKFQRIEEECSGVTCMDSQCPHVACWPVIEFLLELLFVGSLFQVSD
LKSMAQDRLLRLLPKTPAENVLQIAAAAAAQQGCEALQEMCLPILARSNTPALAIEKSLL
AHAPALVRDIAQLRHRLGIHPVDAAEDKRWRRVYKALDSDDVELMGMLLSESNSSVDSVY
ALHYAASYCDRKTLTELLDLGLGDVNLRDRYGYTVLHAATLRRVPEVVGLLLGKGASPLD
TTPEGYTALQVSRRIARNIEPLESAEAREDWLRDRICVEILEQADRANPCPVFPVPMGER
ELLMRLLYLENRVAFARLLWPRECKVVLGLSQLDTTKEFSMEDTSSLMDLNKEPTRSDTD
INSSLLQRVNALQRAIEVGHRFFPRCTAILNSYMDDGSFEHECIQNRRIPEDQLRLLAKL
KRVTDDKQLSEAYQRDVEEHHNLEHHNFGDNACLYSN
Download sequence
Identical sequences D8TAI9
XP_002992598.1.77236 jgi|Selmo1|135647|e_gw1.138.58.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]