SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|157803|estExt_Genewise1.C_720004 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|157803|estExt_Genewise1.C_720004
Domain Number 1 Region: 1032-1292
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.24e-43
Family Hypothetical protein VC1974 0.0033
Further Details:      
 
Domain Number 2 Region: 1-176
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-38
Family Pyruvate oxidase and decarboxylase Pyr module 0.0015
Further Details:      
 
Domain Number 3 Region: 770-970
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.99e-38
Family D-glucarate dehydratase-like 0.0014
Further Details:      
 
Domain Number 4 Region: 452-604
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.46e-17
Family Pyruvate oxidase and decarboxylase PP module 0.012
Further Details:      
 
Domain Number 5 Region: 628-742
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.000000000000645
Family Enolase N-terminal domain-like 0.0042
Further Details:      
 
Domain Number 6 Region: 159-169,214-370
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0000000194
Family Pyruvate oxidase and decarboxylase, middle domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|157803|estExt_Genewise1.C_720004
Sequence length 1298
Sequence
MVWARLLVDECCRLGVTYFCVAPGSRSSPLAEAAAANPRVTCISCVDERSLGFYALGYGR
GARRPAAVVITSGTAMSNLLPAVVEASQDCVPLLILSADRPHELRDVGANQSINQVKHFG
SFVRFDFDLPPATDEVPARMVLTTLDTAIFRATTDPYGPVHVNCPFREPLEAVRTEWDLE
CLEGLSQWMASASPFTTYIPSSTSSLLDGTATLYTSSQMKEVSSLIASASRGVIVAGGLN
QSQTTWAVFKLAKHLRWPLVPDVLSGLRLASKEEDMDVKIIHNLDHVLLNPSLHPSVAPD
IILQIGSRITSKRLSQFLQECSPRAYILVEEHPYRHDPGHRLTHRIKSSAGEFARFVMKE
LTEPEFPERCHSYGMWLHVLSDTVRREILFQLQAEATLTEPCIARIVSSSITTESAVFLG
NSMPIRDVDMYADGLTDQQSLLGDQNLPAMVSIGANRGASGIDGVISTAVGFAAGSNKRV
TLLIGDLSFLHDTNGLMFLTGREAQPPVTLVVVNNRGGGIFSLLPAAGLMPAVTFRNLIS
SEHDVHLDKLCHAHRINHILVQSKAELVRALQDSRTSTSSWVIEVASNIQKNANFHRFLQ
QAIHCHLDRVLPVLSRHVSADKKIIVAVETSPYSFPLTSRLTTGAAEFYRQGFLLRLVLN
NGFSGYGEVAPLPGVHEEDLLDVEMQLSILCGKLTGVELPENVALLDGSFSQWLRTNLGP
QAETIFPSVRCGLEMAALEALAASHNCSLLSVCNGRPSDVSICGLIDMSEGTPDDVASVA
EQLVHEGFTTLKMKVARRALPTQDAAVVVAVRQRVGRSIHLRVDANRRWTLSQAVQFAEA
VRECDIQYLEEPVNNHASLPAFLKQTQVRVALDETIDLNPSCFEKVLESAPLGNIVAAVI
KPGRLGGFENAYMLCRLSLNHNIRPVISACFESSLSLAAYAQFAAFVDGQSPLPSVAHGL
GTYAWIERDAVGRSFSSIVNKGIVSAGAVNAVASTLLQFNPPKPRARSFTSTVALGGYCF
TFRVVEVASMLQEKQTVVFLHGFLGSAEDWLPVMHSLASSFRCLAVDLPGHGRASSVTGN
LEAEWGLDVLSAALSELLEQLSEGSEIVLAGYSMGARIALYMALHKHQKIRAAVIVSGSP
GLRDKQARIIRATQDDSLALSLRLGGLDNFVVNWYKRPLWKSLRRHPDFKNLIASRLAMH
KGNEVALAGALSQLSVGRQPCLWEQLHTASIPLLVVVGKADEKFVSIASEMVYAFKTFDK
GSALKVVRIDGSGHCVPIESPLLLVQALHSFMLGVGLN
Download sequence
Identical sequences D8SS24
jgi|Selmo1|157803|estExt_Genewise1.C_720004 XP_002986213.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]