SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|413039|fgenesh2_pg.C_scaffold_19000261 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|413039|fgenesh2_pg.C_scaffold_19000261
Domain Number 1 Region: 209-290
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-16
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|413039|fgenesh2_pg.C_scaffold_19000261
Sequence length 299
Sequence
MPLQAAAAAAAGVLRGLKLLGGADDHTICAGRRGGPASHQLARKTQCAPHRDIYGEMTSK
DFSGLLVLADAAALQPSFSKFVLRRKRSPRKSMLWRALLWFTADMSTSEPDSNSKRRVIN
QEAGQLHEKKRRKVVVMDECQQLGQKVKKLKMGDRDYGSRTDEVKDSSSSGEDGAIQPAG
DTKKTKCHKWRPRKREDPLVTCDPSRWALLFDKKLTASDVNSLHRLLIPVKYESILPNDQ
KVLVEFVDEEGGVWELRCKKGKTGSLITTHWIHYVREHSLKEGDTVCFYKKVSSADPKF
Download sequence
Identical sequences D8RN53
jgi|Selmo1|413039|fgenesh2_pg.C_scaffold_19000261 XP_002972572.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]