SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|417284|fgenesh2_pg.C_scaffold_34000060 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|417284|fgenesh2_pg.C_scaffold_34000060
Domain Number 1 Region: 261-352
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-17
Family B3 DNA binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|417284|fgenesh2_pg.C_scaffold_34000060
Sequence length 358
Sequence
MTGKIRSPLSATEFLHIGIANATVSEAPELFAGCEVATYLTGKVPWLELPSEIGEYYRSS
GAGNLDLLERCDLFSPDQKPGNHSTWHVLDAMNTSPIAHFKKYKLNALIDRDMSSLMLTH
DGVLKVIWNWNDYCNEWGVNCEDVFQAYTLAPKCGKHLVGSVEGPKFRTRSELGMENAGS
LMHKHYPRLLTSQALQALIKGLLGKSYNTVEGSYEEDSPLSSYIPSNQQRQRRNREELPG
SHEALQAAQEYQQHLAKKSRSTIKVLNQCCVSGTYVMTLPSNYCKKMMPHGRAEVIVRDR
SGHQWRMRWNWTMQPVIGAGWKAFCVHHELVKGDVLVFQKENSSSEMITFRVEIFKRQ
Download sequence
Identical sequences D8S2Q4
jgi|Selmo1|417284|fgenesh2_pg.C_scaffold_34000060 XP_002977496.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]