SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|86822|e_gw1.8.915.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|86822|e_gw1.8.915.1
Domain Number 1 Region: 78-407
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.55e-78
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000167
Further Details:      
 
Domain Number 2 Region: 462-535
Classification Level Classification E-value
Superfamily DUSP-like 0.000000000000235
Family DUSP, domain in ubiquitin-specific proteases 0.008
Further Details:      
 
Domain Number 3 Region: 895-956
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000794
Family Ubiquitin-related 0.023
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|86822|e_gw1.8.915.1
Domain Number - Region: 703-757
Classification Level Classification E-value
Superfamily DUSP-like 0.000575
Family DUSP, domain in ubiquitin-specific proteases 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|86822|e_gw1.8.915.1
Sequence length 1009
Sequence
RRIHLTKIVTEEDLRWFFHLDRPACQGCRGNTKDNPLCLCGLVPPANGTRKHGLWQKLSD
IIDELGPDPSRELRVMDIPAGLTNLGATCYVNSVLQCLFMNTTFRNGVFSAEMELVRNDP
VLHQLARLFAQLHSGTKSSVDSAAFATTLELDNAVQQDGQEFLKLLLTLLERVLAQSRVP
EARDVVQNLFRGTFSYVTKCSSCGKESGASDQFVDFYELEVNVKGFSSLEESLDDYLNEE
KLSGENQYFCEYCKARVDATHSTKLRLLPPVLNFQLKRFVFNLKTSTKKKVTSKFMFPKV
LDMERRVSPVTSDGSPGEPAHYDLFAILMHKGNMASSGHYVVHIRDERTGQWWQFDDEEV
TMLGSNPLGEPTSKLDKVSPDRDDNLLMSPDAYMLMFSRRTSTPRVAEEPVRSIPEFLKA
EVDEQNYSLMSSCEVYNLMKDEEEQRIVERRAEVREVLANARPTAPKGFWISAEWLRNWT
DSLKPPSAIDNSILLCEHERVSPKSIQLMKCISDAAWQSLHSKYGGEPVLTMESCCFECI
YADAGAAATAESFRSGRAAMKLMAENVMAGKGLEGHLFYVSKSWLVQWMRKKAALDTLGD
GDLNPTSAITCRHNALLPDDAAGAKRQVVPEVLWSYFYQNAVLVGGEEQRGHKPFPVNTE
NCKICEAEHSHTLTKCLMLSFRATKMEQRQKQEAIFSGRNPVLNPGDVYYLVPSSWISLW
RAYIGASGKNVLDIEEPVGLERFLSSLLCKHGGLLYNPPALTRTRRGELVQKASSDDVQV
VVSRDDWVYFCQQWDANAGKGIRAYVEEAEMPDRPEKELSELKLPVLRTEPEVCRECIDD
RETTELVHKLNYTNATITVDLVQGKEPPPSLVFAAANQDAERRTSKRARRTVATGNKQVK
LTVSGTTTVYQLKMLIWEWLGVVKENQEVHFGKVELTDESTTLADVGVLPNSQLWVSDSG
LHEHRDIAGKPMLSLFIYVSLIASLWFSQTSSRLHSRAMLKKVLGGRGF
Download sequence
Identical sequences D8R720
jgi|Selmo1|86822|e_gw1.8.915.1 XP_002966847.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]