SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56410473|ref|YP_145847.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56410473|ref|YP_145847.1|
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.1e-40
Family Nitrogenase iron protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56410473|ref|YP_145847.1|
Sequence length 265
Comment chromosome partitioning protein [Geobacillus kaustophilus HTA426]
Sequence
MAITITMGIQKGGCGKSTTTGVLAYLLSRDGYRVLAVDMDSQGNLTELLSRKPSNEFTEK
SVLEAMQERDPEPYIVKVNDRLDLLPANNFLATFPRWIYTGETYLGKYIRYKGKPTLILD
DTLDKIRHRYDFIVIDTPPSLSEQTTNALCASQYVIMMFECSNWCYSAVPNFMESVEGAR
VHGRHNTRLLGILRTMNDVRRNDAKAFNEMIEEDYPNEVFKTIITRKAPIGRLSLYGFEE
NNELNQALEQYENFYKEMMERVQSR
Download sequence
Identical sequences A0A0G3Y482 A0A0N1KF59 A0A164AJ71 A0A1V4PBR2 B1GUN6 Q5QL31
gi|169636461|ref|YP_001716002.1|NC_010420 gi|56410473|ref|YP_145847.1|NC_006509 235909.GKP36 gi|56410473|ref|YP_145847.1| WP_011229510.1.14676 WP_011229510.1.2219 WP_011229510.1.3446 WP_011229510.1.90668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]